LETM1 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-LETM1 antibody: synthetic peptide directed towards the middle region of human LETM1. Synthetic peptide located within the following region: MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 60 kDa |
| Gene Name | leucine zipper and EF-hand containing transmembrane protein 1 |
| Database Link | |
| Background | This gene encodes a protein that is localized toThe inner mitochondrial membrane.The protein functions to maintainThe mitochondrial tubular shapes and is required for normal mitochondrial morphology and cellular viability. Mutations inThis gene cause Wolf-Hirschhorn syndrome, a complex malformation syndrome caused byThe deletion of parts ofThe distal short arm of chromosome 4. Related pseudogenes have been identified on chromosomes 8, 15 and 19. provided by RefSeq, Oct 2009 |
| Synonyms | leucine zipper-EF-hand containing transmembrane protein 1 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 86% |
| Reference Data | |
| Protein Categories | Membrane Proteins |
| Protein Families | Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.