OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MAN1A2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341856
Rabbit Polyclonal Anti-MAN1A2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "MAN1A2 or NM_006699" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MAN1A2 antibody: synthetic peptide directed towards the middle region of human MAN1A2. Synthetic peptide located within the following region: FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 73 kDa
Gene Name mannosidase alpha class 1A member 2
Database Link
Background Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells. See MAN2A1 (MIM 154582) for general information. supplied by OMIM, Mar 2008. ##Evidence-Data-START## Transcript exon combination :: BC052954.1, AF027156.1 ECO:0000332 RNAseq introns :: single sample supports all introns ERS025081, ERS025082 ECO:0000348 ##Evidence-Data-END##
Synonyms MAN1B
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Protein Pathways Metabolic pathways, N-Glycan biosynthesis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products