OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Corin Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341849
Rabbit Polyclonal Anti-Corin Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "Corin or NM_016869" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Corin antibody is: synthetic peptide directed towards the C-terminal region of Mouse Corin. Synthetic peptide located within the following region: MGNKMPFKLQEGEVRIIPLEQCQSYFDMKTITNRMICAGYESGTVDSCMG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 123 kDa
Gene Name corin
Database Link
Background Corin is a Serine-type endopeptidase involved in atrial natriuretic peptide hormone (NPPA) processing. It converts through proteolytic cleavageThe non-functional propeptide NPPA intoThe active hormone,Thereby regulating blood pressure in heart and promoting natriuresis, diuresis and vasodilation. Proteolytic cleavage of pro-NPPA also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Corin also acts as a regulator of sodium reabsorption in kidney. May also process pro-NPPBThe B-type natriuretic peptide.
Synonyms ATC2; CRN; Lrp4; MGC119742; pro-ANP-convertase; PRSC; TMPRSS10
Note Immunogen Sequence Homology: Human: 100%; Zebrafish: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Mouse: 86%; Bovine: 86%
Reference Data
Protein Categories Enzyme: Peptidases, Intracellular Proteins, Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products