OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Nr1i3 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341839
Rabbit Polyclonal Anti-NR1I3 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $525.00
2 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "Nr1i3 or NM_009803" antibodies

Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the C terminal of mouse NR1I3. Synthetic peptide located within the following region: QQSRLQSRFLYAKLMGLLADLRSINNAYSYELQRLEELSAMTPLLGEICS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 39 kDa
Gene Name nuclear receptor subfamily 1, group I, member 3
Database Link
Background NR1I3 mediatesThe induction of transcription of cytochrome P450 (CYP) genes by phenobarbital (PB) and PB-type inducers. NR1I3 activation induces hepatic expression of detoxification enzymes and transporters and increases liver size. NR1I3 can also regulate both liver homeostasis and tumorigenesis in response to xenobiotic stresses.
Synonyms CAR; CAR1; MB67; MGC97144; MGC97209; MGC150433; OTTHUMP00000032246
Note Immunogen Sequence Homology: Mouse: 100%
Reference Data
Protein Categories Intracellular Proteins, Transciption Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products