SMYD1 Rabbit Polyclonal Antibody

SKU TA341836

Rabbit Polyclonal Anti-SMYD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SMYD1 antibody: synthetic peptide directed towards the N terminal of mouse SMYD1. Synthetic peptide located within the following region: MENVEVFTSEGKGRGLKATKEFWAADVIFAERAYSAVVFDSLINFVCHTC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 52 kDa
• Gene Name: SET and MYND domain containing 1
• Database Link:
  NP_938015
  Q8NB12
• Background: SMYD1 is a histone methyltransferases and plays a critical role in myofibril organization during myofiber maturation
• Synonyms: BOP; KMT3D; ZMYND18; ZMYND22
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Human: 93%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome