Elf3 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | IHC, WB |
|---|---|
| Recommended Dilution | WB, IHC |
| Reactivity | Human, Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Elf3 antibody: synthetic peptide directed towards the N terminal of mouse Elf3. Synthetic peptide located within the following region: MAATCEISNVFSNYFNAMYSSEDPTLAPAPPTTFGTEDLVLTLNNQQMTL |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 41 kDa |
| Gene Name | E74-like factor 3 |
| Database Link | |
| Background | Elf3 is a transcriptional activator that binds and transactivates ETS sequences containingThe consensus nucleotide core sequence GGAAT. It acts synergistically with POU2F3 to transactivateThe SPRR2A promoter and with RUNX1 to transactivateThe ANGPT1 promoter (By similarity). It also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. IT represses KRT4 promoter activity (By similarity). It may play an important role in epithelial cell differentiation and tumorigenesis and may be a critical downstream effector ofThe ERBB2 signaling pathway (By similarity). It may be associated with mammary gland development and involution. It plays an important role inThe regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development. |
| Synonyms | EPR-1; ERT; ESE-1; ESX; JEN; OTTHUMP00000034052 |
| Note | Immunogen Sequence Homology: Mouse: 100%; Rat: 93% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Transciption Factors |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
