Arntl Rabbit Polyclonal Antibody

SKU
TA341745
Rabbit Polyclonal Anti-Arntl Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Arntl antibody is: synthetic peptide directed towards the C-terminal region of Mouse Arntl. Synthetic peptide located within the following region: GQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 69 kDa
Gene Name aryl hydrocarbon receptor nuclear translocator-like
Database Link
Background The protein encoded byThis gene is a basic helix-loop-helix protein that forms a heterodimer with Clock.This heterodimer binds E-box enhancer elements upstream of Period (Per1, Per2, Per3) and Cryptochrome (Cry1, Cry2) genes and activates transcription ofThese genes. Per and Cry proteins heterodimerize and repressTheir own transcription by interacting in a feedback loop with Clock/Arntl complexes. Defects inThis gene have been linked to infertility, problems with gluconeogenesis and lipogenesis, and altered sleep patterns. Two transcript variants encoding different isoforms have been found forThis gene. provided by RefSeq, Jan 2014
Synonyms bHLHe5; BMAL1; BMAL1c; JAP3; MGC47515; MOP3; PASD3; TIC
Note Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Human: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 87%
Reference Data
Protein Categories Intracellular Proteins, Transciption Factors
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.