OriGene Logo

MCM9 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341692
Rabbit Polyclonal Anti-MCM9 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY407170 Transient overexpression lysate of minichromosome maintenance complex component 9 (MCM9) 100 ug
$436.00

View other "MCM9 or NM_153255" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MCM9 antibody: synthetic peptide directed towards the N terminal of human MCM9. Synthetic peptide located within the following region: NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 44 kDa
Gene Name minichromosome maintenance 9 homologous recombination repair factor
Database Link
Background The protein encoded byThis gene is a member ofThe mini-chromosome maintenance (MCM) protein family that are essential forThe initiation of eukaryotic genome replication. Binding ofThis protein to chromatin has been shown to be a pre-requisite for recruitingThe MCM2-7 helicase to DNA replication origins.This protein also binds, and is a positive regulator of,The chromatin licensing and DNA replication factor 1, CDT1. provided by RefSeq, Nov 2010
Synonyms C6orf61; dJ329L24.1; dJ329L24.3; MCMDC1; ODG4
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 86%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.