MCM7 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | IHC, WB |
|---|---|
| Recommended Dilution | WB, IHC |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-MCM7 antibody: synthetic peptide directed towards the middle region of human MCM7. Synthetic peptide located within the following region: HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 81 kDa |
| Gene Name | minichromosome maintenance complex component 7 |
| Database Link | |
| Background | The protein encoded byThis gene is one ofThe highly conserved mini-chromosome maintenance proteins (MCM) that are essential forThe initiation of eukaryotic genome replication.The hexameric protein complex formed byThe MCM proteins is a key component ofThe pre-replication complex (pre_RC) and may be involved inThe formation of replication forks and inThe recruitment of other DNA replication related proteins.The MCM complex consisting ofThis protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate withThis protein, and may regulateThe binding ofThis protein withThe tumorsuppressor protein RB1/RB. Alternatively spliced transcript variants encoding distinct isoforms have been reported. provided by RefSeq, Jul 2008 |
| Synonyms | CDC47; MCM2; P1.1-MCM3; P1CDC47; P85MCM; PNAS146; PPP1R104 |
| Note | Immunogen Sequence Homology: Human: 100%; Rat: 92%; Horse: 92%; Bovine: 92%; Rabbit: 92%; Pig: 85%; Guinea pig: 85% |
| Reference Data | |
| Protein Categories | Growth Factors, Intracellular Proteins |
| Protein Families | Transcription Factors |
| Protein Pathways | Cell cycle, DNA replication |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.