OriGene Logo

GJB4 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341676
Rabbit Polyclonal Anti-GJB4 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $525.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY407141 Transient overexpression lysate of gap junction protein, beta 4, 30.3kDa (GJB4) 100 ug
$436.00
TP304406 Recombinant protein of human gap junction protein, beta 4, 30.3kDa (GJB4), 20 µg
20 ug
$867.00

View other "GJB4 or NM_153212" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GJB4 antibody: synthetic peptide directed towards the middle region of human GJB4. Synthetic peptide located within the following region: CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 29 kDa
Gene Name gap junction protein beta 4
Database Link
Background This gene encodes a transmembrane connexin protein that is a component of gap junctions. Mutations inThis gene have been associated with erythrokeratodermia variabilis, progressive symmetric erythrokeratoderma and hearing impairment. provided by RefSeq, Dec 2009
Synonyms CX30.3; EKV
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 92%; Rat: 92%; Bovine: 92%; Mouse: 86%
Reference Data
Protein Categories Membrane Proteins
Protein Families Ion Channels: Other, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.