IFT140 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human, Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-IFT140 antibody: synthetic peptide directed towards the N terminal of human IFT140. Synthetic peptide located within the following region: VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 165 kDa |
| Gene Name | intraflagellar transport 140 |
| Database Link | |
| Background | This gene encodes one ofThe subunits ofThe intraflagellar transport (IFT) complex A. Intraflagellar transport is involved inThe genesis, resorption and signaling of primary cilia.The primary cilium is a microtubule-based sensory organelle atThe surface of most quiescent mammalian cells, that receives signals from its environment, such asThe flow of fluid, light or odors, and transduces those signals toThe nucleus. Loss ofThe corresponding protein in mouse results in renal cystic disease. provided by RefSeq, Jun 2012 |
| Synonyms | c305C8.4; c380F5.1; gs114; MZSDS; SRTD9; WDTC2 |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%; Bovine: 92% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Nervous system Diseases |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
