DNA2 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-DNA2L antibody: synthetic peptide directed towards the middle region of human DNA2L. Synthetic peptide located within the following region: KLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGGVSNVTE |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 54 kDa |
| Gene Name | DNA replication helicase/nuclease 2 |
| Database Link | |
| Background | DNA2 is a conserved helicase/nuclease involved inThe maintenance of mitochondrial and nuclear DNA stability (Duxin et al., 2009 PubMed 19487465). supplied by OMIM, Nov 2010. Transcript Variant:This variant (1) representsThe longer transcript and encodesThe functional protein. CCDS Note:The coding region has been updated to shortenThe N-terminus to one that is more supported byThe available transcript, conservation and publication data. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: D42046.1 ECO:0000332 RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 ECO:0000350 ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end. |
| Synonyms | DNA2L; hDNA2 |
| Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Bovine: 92%; Rat: 86%; Horse: 86%; Rabbit: 85%; Guinea pig: 85% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Nervous system Diseases |
| Protein Pathways | DNA replication |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
