RAD54B Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-RAD54B antibody: synthetic peptide directed towards the N terminal of human RAD54B. Synthetic peptide located within the following region: RRSAAPSQLQGNSFKKPKFIPPGRSNPGLNEEITKLNPDIKLFEGVAINN |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 103 kDa |
| Gene Name | RAD54 homolog B (S. cerevisiae) |
| Database Link | |
| Background | The protein encoded byThis gene belongs toThe DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA.This protein binds to double-stranded DNA, and displays ATPase activity inThe presence of DNA.This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations ofThis gene were observed in primary lymphoma and colon cancer. provided by RefSeq, Jul 2008 |
| Synonyms | RDH54 |
| Note | Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Rabbit: 85%; Rat: 79% |
| Reference Data | |
| Protein Categories | Cancer: Haematopoietic and Lymphoid, Intracellular Proteins |
| Protein Families | Druggable Genome |
| Protein Pathways | Homologous recombination |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.