QRX (RAX2) Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-RAXL1 antibody: synthetic peptide directed towards the N terminal of human RAXL1. Synthetic peptide located within the following region: MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASH |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 20 kDa |
| Gene Name | retina and anterior neural fold homeobox 2 |
| Database Link | |
| Background | This gene encodes a homeodomain-containing protein that plays a role in eye development. Mutation ofThis gene causes age-related macular degeneration type 6, an eye disorder resulting in accumulations of protein and lipid beneathThe retinal pigment epithelium and withinThe Bruch's membrane. Defects inThis gene can also cause cone-rod dystrophy type 11, a disease characterized byThe initial degeneration of cone photoreceptor cells and resulting in loss of color vision and visual acuity, followed byThe degeneration of rod photoreceptor cells, which progresses to night blindness andThe loss of peripheral vision. provided by RefSeq, Jul 2008 |
| Synonyms | ARMD6; CORD11; QRX; RAXL1 |
| Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Dog: 85% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Nervous system Diseases, Transciption Factors |
| Protein Families | Transcription Factors |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
