WFDC5 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-WFDC5 antibody: synthetic peptide directed towards the N terminal of human WFDC5. Synthetic peptide located within the following region: MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCV |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 11 kDa |
| Gene Name | WAP four-disulfide core domain 5 |
| Database Link | |
| Background | WFDC5 is a putative acid-stable proteinase inhibitor.This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. |
| Synonyms | dJ211D12.5; PRG5; WAP1 |
| Note | Immunogen Sequence Homology: Human: 100%; Pig: 86%; Guinea pig: 85%; Bovine: 79% |
| Reference Data | |
| Protein Categories | Secreated Proteins |
| Protein Families | Secreted Protein |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
