STK32A Rabbit Polyclonal Antibody

SKU TA340378

Rabbit Polyclonal Anti-STK32A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STK32A antibody: synthetic peptide directed towards the N terminal of human STK32A. Synthetic peptide located within the following region: GANTSRKPPVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 20 kDa
• Gene Name: serine/threonine kinase 32A
• Database Link:
  NP_659438
  Q8WU08
• Background: STK32A belongs to the protein kinase superfamily, Ser/Thr protein kinase family. It contains 1 protein kinase domain. The function of the STK32A protein remains unknown.
• Synonyms: YANK1
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Rabbit: 93%; Mouse: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Horse: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase