OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EFHB Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA340363
Rabbit Polyclonal Anti-EFHB Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY408165 Transient overexpression lysate of EF-hand domain family, member B (EFHB) (as WB positive control) 100 ug
$436.00
TP307068 Recombinant protein of human EF-hand domain family, member B (EFHB), 20 µg
20 ug
$867.00

View other "EFHB or NM_144715" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-EFHB antibody is: synthetic peptide directed towards the C-terminal region of Human EFHB. Synthetic peptide located within the following region: YGEEGSAYSLLYPTIFARKGVFERDFFKTRSKEEIAEILCNIGVKLSDEE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 77 kDa
Gene Name EF-hand domain family member B
Database Link
Background The function of this protein remains unknown.
Synonyms CFAP21
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

EFHB is a Novel Cytosolic Ca2+ Sensor That Modulates STIM1-SARAF Interaction
Albarran, Lopez, Jardin et al
Cell. Physiol. Biochem. (2018) 51 (3), 1164-1178 DOI: 10.1159/000495494
AI Summary: OriGene’s rabbit polyclonal anti-EFHB antibody (catalog number TA340363) was used in this study to detect EFHB protein via Western blotting and immunoprecipitation, enabling the authors to characterize EFHB’s role as a novel regulator of store-operated Ca2+ entry.
Snippet: San Diego, CA, USA). Rabbit polyclonal anti-EFHB antibody (catalog number TA340363, epitope: amino acids 743-792 of human EFHB (C-terminal)) was from OriGene (Herford, Germany). Horseradish peroxidase-conjugated
WB IP
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products