GPRASP2 Rabbit Polyclonal Antibody

CAT#: TA340292

Rabbit Polyclonal Anti-GPRASP2 Antibody


 Product Datasheet for 'TA340292'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-GPRASP2 antibody: synthetic peptide directed towards the middle region of human GPRASP2. Synthetic peptide located within the following region: EQESLLQPDQPSPEFTFQYDPSYRSVREIREHLRARESAESESWSCSCIQ
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1mg/mL
Purification Affinity Purified
Predicted Protein Size 94 kDa
Gene Name G protein-coupled receptor associated sorting protein 2
Background The exact function of FAM14A remains unknown.
Synonyms GASP2
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Guinea pig: 91%; Rabbit: 85%
Reference Data
Protein Families Druggable Genome
Other products for "GPRASP2"
Frequently bought together (2)
Transient overexpression lysate of G protein-coupled receptor associated sorting protein 2 (GPRASP2), transcript variant 2
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones