OriGene Logo

NEURL2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA340249
Rabbit Polyclonal Anti-NEURL2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY409066 Transient overexpression lysate of neuralized homolog 2 (Drosophila) (NEURL2) 100 ug
$436.00
TP312983 Purified recombinant protein of Homo sapiens neuralized homolog 2 (Drosophila) (NEURL2), 20 µg
20 ug
$867.00

View other "NEURL2 or NM_080749" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NEURL2 antibody: synthetic peptide directed towards the N terminal of human NEURL2. Synthetic peptide located within the following region: MAAASEPVDSGALWGLERPEPPPTRFHRVHGANIRVDPSGTRATRVESFA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 32 kDa
Gene Name neuralized E3 ubiquitin protein ligase 2
Database Link
Background NEURL2 contains 1 NHR (neuralized homology repeat) domain and 1 SOCS box domain. NEURL2 plays an important role in the process of myofiber differentiation and maturation. NEURL2 is the probable substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex, which mediates the ubiquitination of proteins. NEURL2 probably contributes to catalysis through recognition and positioning of the substrate and the ubiquitin-conjugating enzyme. During myogenesis, it controls the ubiquitination and degradation of the specific pool of CTNNB1/beta-catenin located at the sarcolemma.
Synonyms C20orf163; OZZ; OZZ-E3
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Horse: 86%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.