OriGene Logo

RHPN1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA340220
Rabbit Polyclonal Anti-RHPN1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY409382 Transient overexpression lysate of rhophilin, Rho GTPase binding protein 1 (RHPN1) 100 ug
$436.00
TP306645 Recombinant protein of human rhophilin, Rho GTPase binding protein 1 (RHPN1), 20 µg
20 ug
$867.00

View other "RHPN1 or NM_052924" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RHPN1 antibody: synthetic peptide directed towards the middle region of human RHPN1. Synthetic peptide located within the following region: SAKNRWRLVGPVHLTRGEGGFGLTLRGDSPVLIAAVIPGSQAAAAGLKEG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 73 kDa
Gene Name rhophilin, Rho GTPase binding protein 1
Database Link
Background RHPN1¡¡has no enzymatic activity. RHPN1 may serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho signal to other molecules.
Synonyms ODF5; RHOPHILIN; RHPN
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 92%; Zebrafish: 86%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.