GABARAPL2 Rabbit Polyclonal Antibody

CAT#: TA340174

Rabbit Polyclonal Anti-GABARAPL2 Antibody

Product Images

WB Suggested Anti-GABARAPL2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysateGABARAPL2 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GABARAPL2 antibody: synthetic peptide directed towards the N terminal of human GABARAPL2. Synthetic peptide located within the following region: KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: GABA type A receptor associated protein like 2
• Database Link:
  NP_009216
  Entrez Gene 11345 Human
  UniProt ID P60520
• Background: GABARAPL2 belongs to the MAP1 LC3 family. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. The protein first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.
• Synonyms: ATG8; ATG8C; GATE-16; GATE16; GEF-2; GEF2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data

• Protein Pathways: Regulation of autophagy