OriGene Logo

CELA1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA340038
Rabbit Polyclonal Anti-ELA1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY419617 Transient overexpression lysate of chymotrypsin-like elastase family, member 1 (CELA1) 100 ug
$436.00

View other "CELA1 or NM_001971" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ELA1 antibody: synthetic peptide directed towards the N terminal of human ELA1. Synthetic peptide located within the following region: LVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGT
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 28 kDa
Gene Name chymotrypsin like elastase family member 1
Database Link
Background Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 (ELA1) expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas is actually referring to elastase 2A.Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas is actually referring to elastase 2A. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-867 BC069454.1 1-867 868-952 AF120493.1 868-952
Synonyms ELA1
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 92%; Mouse: 77%
Reference Data
Protein Categories Enzyme: Peptidases, Intracellular Proteins, Secreated Proteins
Protein Families Druggable Genome, Protease, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.