EIF2B1 Rabbit Polyclonal Antibody

CAT#: TA340021

Reviews ()
Write a review

Rabbit Polyclonal Anti-EIF2B1 Antibody


Product Datasheet for 'TA340021'


Promo! Get it for USD 289.00, only with code 289*.

(*) Valid from April 1st to September 30th, 2020. See details »

USD 375.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-EIF2B1 antibody: synthetic peptide directed towards the C terminal of human EIF2B1. Synthetic peptide located within the following region: ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml
Purification Affinity Purified
Predicted Protein Size 34 kDa
Gene Name eukaryotic translation initiation factor 2B subunit alpha
Background EIF2B1 belongs to the EIF-2B alpha/beta/delta subunits family. It catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Defects in EIF2B1 are a cause of leukoencephalopathy with vanishing white matter (VWM).
Synonyms EIF2B; EIF2BA
Note Immunogen Sequence Homology: Human: 100%; Horse: 93%; Mouse: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Bovine: 79%; Rabbit: 79%
Reference Data
Other products for "EIF2B1"
Frequently bought together (2)
Transient overexpression lysate of eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa (EIF2B1)
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies