TOM1L2 Rabbit Polyclonal Antibody

SKU TA339987

Rabbit Polyclonal Anti-TOM1L2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TOM1L2 antibody: synthetic peptide directed towards the middle region of human TOM1L2. Synthetic peptide located within the following region: QPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDLPSP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: target of myb1 like 2 membrane trafficking protein
• Database Link:
  NP_001076437
  Q6ZVM7
• Background: TOM1L2 has a probable role in protein transport.TOM1L2 may regulate growth factor-induced mitogenic signaling.
• Synonyms: FLJ21501; FLJ32746
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data