OriGene Logo

MDH1B Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339976
Rabbit Polyclonal Anti-MDH1B Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY421838 Transient overexpression lysate of malate dehydrogenase 1B, NAD (soluble) (MDH1B) 100 ug
$436.00
TP310625 Recombinant protein of human malate dehydrogenase 1B, NAD (soluble) (MDH1B), 20 µg
20 ug
$867.00

View other "MDH1B or NM_001039845" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MDH1B antibody: synthetic peptide directed towards the middle region of human MDH1B. Synthetic peptide located within the following region: YQSGHKDLVPDEEKNLAMSDAAEFPNQIPQTTFEKPQSLEFLNEFEGKTV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 59 kDa
Gene Name malate dehydrogenase 1B
Database Link
Background The function of this protein remains unknown.
Synonyms RP11-95H11
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.