LRRC17 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-LRRC17 antibody: synthetic peptide directed towards the middle region of human LRRC17. Synthetic peptide located within the following region: YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHEL |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 52 kDa |
| Gene Name | leucine rich repeat containing 17 |
| Database Link | |
| Background | LRRC17 contains 6 LRR (leucine-rich) repeats. The exact function of LRRC17 remains unknown. |
| Synonyms | P37NB |
| Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 93%; Rabbit: 93%; Pig: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 86%; Zebrafish: 79% |
| Reference Data | |
| Protein Categories | Cytokines, Secreated Proteins |
| Protein Families | Druggable Genome |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Transcriptome Profile of Membrane and Extracellular Matrix Components in Ligament-Fibroblastic Progenitors and Cementoblasts Differentiated from Human Periodontal Ligament Cells
Mun, Kim, Choi et al
Genes (Basel) (2022) 13 (4) DOI: 10.3390/genes13040659
Mun, Kim, Choi et al
Genes (Basel) (2022) 13 (4) DOI: 10.3390/genes13040659
Cited by 16
AI Summary: In this study, OriGene products—specifically the anti-GPM6B (TA361526) and anti-LRRC17 (TA339973) antibodies—were used to verify the expression of key membrane proteins by Western blot and immunohistochemistry, aiding in the characterization of differentiated ligament-fibroblastic and cementoblastic cells.
Snippet: orin (sc-517034), and anti-versican (sc-47769) antibodies were obtained from Santa Cruz Biotechnology (Dallas, TX, USA). Anti-GPM6B (TA361526) and anti-LRRC17 (TA339973) antibodies were obtained from OriGene (Rockville, MD, USA). Anti-LRRC15 (ab157484) and anti-SCGF (CLEC11A, ab90238) antibodies were obtained from Abcam (Waltham, MA, USA). 3. Results 3.1. Cytodifferentiation of hPDLCs into Ligame
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
