MAS1 Rabbit Polyclonal Antibody

CAT#: TA339886

Rabbit Polyclonal Anti-MAS1 Antibody

Product Images

Host: Rabbit; Target Name: MAS1; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MAS1 antibody is: synthetic peptide directed towards the N-terminal region of Human MAS1. Synthetic peptide located within the following region: VTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: MAS1 proto-oncogene, G protein-coupled receptor
• Database Link:
  NP_002368
  Entrez Gene 4142 Human
  UniProt ID P04201
• Background: The structure of MAS1 indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects.
• Synonyms: MAS; MGRA
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction, Renin-angiotensin system