ASCL4 Rabbit Polyclonal Antibody

SKU TA339845

Rabbit Polyclonal Anti-ASCL4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ASCL4 antibody: synthetic peptide directed towards the N terminal of human ASCL4. Synthetic peptide located within the following region: METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 19 kDa
• Gene Name: achaete-scute family bHLH transcription factor 4
• Database Link:
  NP_982260
  Q6XD76
• Background: ASCL4, a basic helix-loop-helix transcription factor, is essential for the determination of cell fate and the development and differentiation of numerous tissues. It could be a transcriptional regulator involved in skin development.Basic helix-loop-helix transcription factors, such as ASCL4, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]). [supplied by OMIM]
• Synonyms: bHLHa44; HASH4
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data