OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PYHIN1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339836
Rabbit Polyclonal Anti-PYHIN1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY404652 Transient overexpression lysate of pyrin and HIN domain family, member 1 (PYHIN1), transcript variant b2 (as WB positive control) 100 ug
$665.00

View other "PYHIN1 or NM_152501" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PYHIN1 antibody: synthetic peptide directed towards the N terminal of human PYHIN1. Synthetic peptide located within the following region: ANNYKKIVLLKGLEVINDYHFRIVKSLLSNDLKLNPKMKEEYDKIQIADL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 55 kDa
Gene Name pyrin and HIN domain family member 1
Database Link
Background PYHIN1 belongs to the HIN-200 family. This protein is major mediator of the tumor suppressor activity of IFN in breast cancer cells. It promotes ubiquitination and subsequent degradation of MDM2, which leads to p53/TP53 stabilization, and HDAC1, which in turn enhances maspin expression, and impairs invasive activity of cancer cells.
Synonyms IFIX
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 93%; Dog: 91%; Horse: 91%; Bovine: 91%; Pig: 85%; Rat: 85%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products