Scratch 2 (SCRT2) Rabbit Polyclonal Antibody

CAT#: TA339781

Rabbit Polyclonal Anti-SCRT2 Antibody

Product Images

WB Suggested Anti-SCRT2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SCRT2 antibody: synthetic peptide directed towards the middle region of human SCRT2. Synthetic peptide located within the following region: HMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAACAKAAEPPPPTPAGPAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: scratch family transcriptional repressor 2
• Database Link:
  NP_149120
  Entrez Gene 85508 Human
  UniProt ID Q9NQ03
• Background: SCRT2 belongs to the snail C2H2-type zinc-finger protein family. It contains 5 C2H2-type zinc fingers. SCRT2 may be involved in transcriptional regulation.
• Synonyms: ZNF898B
• Note: Immunogen Sequence Homology: Human: 100%; Yeast: 100%; Dog: 92%; Rat: 85%; Pig: 79%; Guinea pig: 79%