BRPF3 Rabbit Polyclonal Antibody

SKU TA339722

Rabbit Polyclonal Anti-BRPF3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BRPF3 antibody: synthetic peptide directed towards the N terminal of human BRPF3. Synthetic peptide located within the following region: CNSNKENSEQPQFPGKSKKPSSKGKKKESCSKHASGTSFHLPQPSFRMVD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 136 kDa
• Gene Name: bromodomain and PHD finger containing 3
• Database Link:
  NP_056510
  Q9ULD4
• Background: BRPF3 contains 1 bromo domain, 1 PHD-type zinc finger and 1 PWWP domain.The exact function of BRPF3 remains unknown.
• Synonyms: 3; bromodomain and PHD finger containing; OTTHUMP00000016287
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 92%

Reference Data

• Protein Families: Druggable Genome