OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LIMD1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339713
Rabbit Polyclonal Anti-LIMD1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY415413 Transient overexpression lysate of LIM domains containing 1 (LIMD1) (as WB positive control) 100 ug
$665.00
TP322723 Recombinant protein of human LIM domains containing 1 (LIMD1), 20 µg
20 ug
$867.00

View other "LIMD1 or NM_014240" antibodies

Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-LIMD1 antibody: synthetic peptide directed towards the N terminal of human LIMD1. Synthetic peptide located within the following region: MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFAT
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 56 kDa
Gene Name LIM domains containing 1
Database Link
Background LIMD1 may be involved in cell anchoring via focal adhesions and in the cell cycle, particularly during mitosis. LIMD1 functionally interacts with pRB and the loss of which promotes lung carcinogenesis. Some breast tumors also have altered expression of LIMD1 RNA. LIMD1 may represent a critical tumor suppressor gene.
Synonyms LIM domains containing 1
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 86%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products