MED4 Rabbit Polyclonal Antibody

SKU TA339711

Rabbit Polyclonal Anti-MED4 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MED4 antibody: synthetic peptide directed towards the middle region of human MED4. Synthetic peptide located within the following region: EEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPST
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 30 kDa
• Gene Name: mediator complex subunit 4
• Database Link:
  NP_054885
  Q9NPJ6
• Background: TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.
• Synonyms: ARC36; DRIP36; HSPC126; TRAP36; VDRIP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors