ZNHIT1 Rabbit Polyclonal Antibody

SKU TA339701

Rabbit Polyclonal Anti-ZNHIT1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNHIT1 antibody: synthetic peptide directed towards the N terminal of human ZNHIT1. Synthetic peptide located within the following region: MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 17 kDa
• Gene Name: zinc finger HIT-type containing 1
• Database Link:
  NP_006340
  O43257
• Background: ZNHIT1 belongs to the ZNHIT1 family. It contains 1 HIT-type zinc finger. ZNHIT1 may play a role in p53-mediated apoptosis induction.
• Synonyms: CG1I; ZNFN4A1
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Zebrafish: 86%

Reference Data