HMX2 Rabbit Polyclonal Antibody

CAT#: TA339686

Rabbit Polyclonal Anti-HMX2 Antibody

Product Images

WB Suggested Anti-HMX2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HMX2 antibody: synthetic peptide directed towards the middle region of human HMX2. Synthetic peptide located within the following region: SPSHSDFKEEKERLLPAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: H6 family homeobox 2
• Database Link:
  NP_005510
  Entrez Gene 3167 Human
  UniProt ID A2RU54
• Background: HMX2 belongs to the HMX homeobox family. It contains 1 homeobox DNA-binding domain. HMX2 is a transcription factor involved in specification of neuronal cell types and which is required for inner ear and hypothalamus development.
• Synonyms: H6L; Nkx5-2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Guinea pig: 93%