ZNF433 Rabbit Polyclonal Antibody

SKU TA339670

Rabbit Polyclonal Anti-ZNF433 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF433 antibody: synthetic peptide directed towards the N terminal of human ZNF433. Synthetic peptide located within the following region: GEVGSAHSSLNRHIRDDTGHKAYEYQEYGQKPYKCKYCKKPFNCLSSVQT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 77 kDa
• Gene Name: zinc finger protein 433
• Database Link:
  NP_001073880
  Q8N7K0
• Background: ZNF433 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 19 C2H2-type zinc fingers and 1 KRAB domain. ZNF433 may be involved in transcriptional regulation.
• Synonyms: FLJ40981
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 90%; Pig: 82%; Horse: 82%

Reference Data

• Protein Families: Transcription Factors