ATP5MK Rabbit Polyclonal Antibody

SKU TA339625

Rabbit Polyclonal Anti-USMG5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-USMG5 antibody: synthetic peptide directed towards the N terminal of human USMG5. Synthetic peptide located within the following region: MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 6 kDa
• Gene Name: up-regulated during skeletal muscle growth 5 homolog (mouse)
• Database Link:
  NP_116136
  Q96IX5
• Background: The function of USMG5 remains unknown.
• Synonyms: bA792D24.4; DAPIT; HCVFTP2
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%; Mouse: 85%; Dog: 79%; Bovine: 79%

Reference Data

• Protein Families: Transmembrane