TTYH3 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-TTYH3 antibody: synthetic peptide directed towards the middle region of human TTYH3. Synthetic peptide located within the following region: IIATLVCSAGIAVGFYGNGETSDGIHRATYSLRHANRTVAGVQDRVWDTA |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 57 kDa |
| Gene Name | tweety family member 3 |
| Database Link | |
| Background | This gene encodes a member of the tweety family of proteins. Members of this family function as chloride anion channels. The encoded protein functions as a calcium(2+)-activated large conductance chloride(-) channel. |
| Synonyms | KIAA1691 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93% |
| Reference Data | |
| Protein Categories | Membrane Proteins |
| Protein Families | Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Accumulation of α-synuclein mediates podocyte injury in Fabry nephropathy
Braun, Abed, Sellung et al
J Clin Invest (2023) 133 (11) DOI: 10.1172/JCI157782
Braun, Abed, Sellung et al
J Clin Invest (2023) 133 (11) DOI: 10.1172/JCI157782
AI Summary: OriGene’s α-galactosidase antibody (TA336243) was used in Western blot experiments to assess protein expression and investigate the molecular mechanisms underlying podocyte injury in Fabry nephropathy.
Snippet: , the systems, and the protocols that were applied in Western blotting can be found in our previous publication (96). The following antibodies were used in Western blot experiments: α-galactosidase (OriGene Technologies, TA336243), α-tubulin (Sigma-Aldrich, T9026), actinin 4 (Abcam, ab108198), p62 (Cell Signaling Technology, 5114), LC3 (Invitrogen, PA1-16931), SNCA (Santa Cruz Biotechnology, sc
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
