ZNF649 Rabbit Polyclonal Antibody

SKU TA339544

Rabbit Polyclonal Anti-ZNF649 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF649 antibody: synthetic peptide directed towards the N terminal of human ZNF649. Synthetic peptide located within the following region: HGRTLKSYLGLTNQSRRYNRKEPAEFNGDGAFLHDNHEQMPTEIEFPESR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 58 kDa
• Gene Name: zinc finger protein 649
• Database Link:
  NP_075562
  Q9BS31
• Background: ZNF649 is the transcriptional repressor. ZNF649 is the regulator of transcriptional factor complexes and may suppress SRE and AP-1 transcription activities mediated by growth factor signaling pathways.
• Synonyms: FLJ12644
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%

Reference Data

• Protein Families: Transcription Factors