OriGene Logo

ZNF649 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339543
Rabbit Polyclonal Anti-FLJ12644 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $525.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY411506 Transient overexpression lysate of zinc finger protein 649 (ZNF649) 100 ug
$436.00

View other "ZNF649 or NM_023074" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FLJ12644 antibody: synthetic peptide directed towards the C terminal of human FLJ12644. Synthetic peptide located within the following region: EKAYFYMSCLVKHKRIHSREKRGDSVKVENPSTASHSLSPSEHVQGKSPV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 58 kDa
Gene Name zinc finger protein 649
Database Link
Background The FLJ12644 gene encodes a protein may act as a transcriptional repressor in mitogen-activated protein kinase signaling pathway to mediate cellular functions.
Synonyms FLJ12644
Note Immunogen Sequence Homology: Human: 100%; Dog: 77%
Reference Data
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.