PRDM9 Rabbit Polyclonal Antibody

CAT#: TA339515

Rabbit Polyclonal Anti-PRDM9 Antibody

Product Images

WB Suggested Anti-PRDM9 Antibody Titration: 1 ug/ml; Positive Control: 293T cells lysate

• 

  Host: Rabbit; Target Name: PRDM9; Sample Tissue: 293T; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: PRDM9; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: PRDM9; Sample Tissue: HepG2; Antibody Dilution: 1.0 ug/ml

• 

  Anti-PRDM9 antibody IHC staining of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

• 

  Anti-PRDM9 antibody IHC staining of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

• Rabbit Anti-PRDM9 Antibody; Paraffin Embedded Tissue: Human Placenta; Antibody Concentration: 5 ug/ml

Show all 7 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRDM9 antibody: synthetic peptide directed towards the middle region of human PRDM9. Synthetic peptide located within the following region: CPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 103 kDa
• Gene Name: PR domain 9
• Database Link:
  NP_064612
  Entrez Gene 56979 Human
  UniProt ID Q9NQV7
• Background: The PR domain is a protein-protein interaction module of about 100 amino acids. PR domain-containing proteins, such as PRDM9, are often involved in transcriptional regulation (Jiang and Huang, 2000 [PubMed 10668202]). [supplied by OMIM, Mar 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: DQ388610.1, AK301776.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025094 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: MEISETZ; MSBP3; PFM6; PRMD9; ZNF899
• Note: Immunogen Sequence Homology: Human: 100%