OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NDST3 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339434
Rabbit Polyclonal Anti-NDST3 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY401504 Transient overexpression lysate of N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (as WB positive control) 100 ug
$665.00
TP317551 Recombinant protein of human N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3), 20 µg
20 ug
$737.00

View other "NDST3 or NM_004784" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NDST3 antibody: synthetic peptide directed towards the N terminal of human NDST3. Synthetic peptide located within the following region: PGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIHDLGLHD
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 101 kDa
Gene Name N-deacetylase/N-sulfotransferase 3
Database Link
Background This gene encodes a member of the heparan sulfate/heparin GlcNAc N-deacetylase/ N-sulfotransferase family. The encoded enzyme is a type II transmembrane protein that resides in the Golgi apparatus. This monomeric bifunctional enzyme catalyzes the N-deacetylation and N-sulfation of N-acetylglucosamine residues in heparan sulfate and heparin, which are the initial chemical modifications required for the biosynthesis of the functional oligosaccharide sequences that define the specific ligand binding activities of heparan sulfate and heparin. provided by RefSeq, Nov 2008
Synonyms HSST3
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Transmembrane
Protein Pathways Heparan sulfate biosynthesis, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products