ECM1 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-ECM1 antibody is: synthetic peptide directed towards the middle region of Human ECM1. Synthetic peptide located within the following region: QDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSH |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 18 kDa |
| Gene Name | extracellular matrix protein 1 |
| Database Link | |
| Background | This gene encodes a soluble protein that is involved in endochondral bone formation, angiogenesis, and tumor biology. It also interacts with a variety of extracellular and structural proteins, contributing to the maintenance of skin integrity and homeostasis. Mutations in this gene are associated with lipoid proteinosis disorder (also known as hyalinosis cutis et mucosae or Urbach-Wiethe disease) that is characterized by generalized thickening of skin, mucosae and certain viscera. Alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. provided by RefSeq, Feb 2011 |
| Synonyms | URBWD |
| Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 86% |
| Reference Data | |
| Protein Categories | Cytokines, Secreated Proteins |
| Protein Families | Secreted Protein, Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.