COX15 Rabbit Polyclonal Antibody

CAT#: TA339409

Rabbit Polyclonal Anti-COX15 Antibody

Product Images

Lanes: Lane 1: 20ug human fibroblast mitochondria; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-Rabbit HRP; Secondary Antibody Dilution: 1: 5000; Gene Name: COX15; Submitted by: Oleh Khalimonchuk, University of Nebraska-Lincoln;

• 

  WB Suggested Anti-COX15 Antibody Titration: 5.0 ug/ml; Positive Control: HepG2 cell lysate.COX15 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

• 

  Rabbit Anti-COX15 Antibody; Paraffin Embedded Tissue: Human Muscle; Cellular Data: Skeletal muscle cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X - See more at: http: //www.avivasysbio.com/cox15-antibody-n-terminal-region-arp46442-t100.

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-COX15 antibody: synthetic peptide directed towards the N terminal of human COX15. Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: COX15 cytochrome c oxidase assembly homolog
• Database Link:
  NP_004367
  Entrez Gene 1355 Human
  UniProt ID Q7KZN9
• Background: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates two transcript variants diverging in the 3' region. [provided by RefSeq, Jul 2008]
• Synonyms: CEMCOX2
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Rabbit: 86%; Yeast: 82%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, Oxidative phosphorylation, Porphyrin and chlorophyll metabolism