OriGene Logo

Cdh7 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339406
Rabbit Polyclonal Anti-Cdh7 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "Cdh7 or NM_001012737" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Rat
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Cdh7 antibody is: synthetic peptide directed towards the N-terminal region of Rat Cdh7. Synthetic peptide located within the following region: WNQFFVLEEYMGSDPLYVGKLHSDVDKGDGFIKYILSGEGASSIFIIDEN
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 86 kDa
Gene Name cadherin 7
Database Link
Background Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
Synonyms cadherin-7; CDH7L1; OTTHUMP00000163685
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 86%; Guinea pig: 86%; Zebrafish: 85%
Reference Data
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.