RFC5 Rabbit Polyclonal Antibody

CAT#: TA339306

Rabbit Polyclonal Anti-RFC5 Antibody

Product Images

WB Suggested Anti-RFC5 Antibody Titration: 1 ug/ml; Positive Control: Jurkat cell lysate.RFC5 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RFC5 antibody: synthetic peptide directed towards the N terminal of human RFC5. Synthetic peptide located within the following region: METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: replication factor C subunit 5
• Database Link:
  NP_031396
  Entrez Gene 5985 Human
  UniProt ID P40937
• Background: The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 36 kD subunit. This subunit can interact with the C-terminal region of PCNA. It forms a core complex with the 38 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 9. [provided by RefSeq, May 2011]
• Synonyms: RFC36
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Mouse: 93%; Bovine: 93%; Zebrafish: 93%; Yeast: 90%

Reference Data

• Protein Families: Stem cell - Pluripotency
• Protein Pathways: DNA replication, Mismatch repair, Nucleotide excision repair