MAT2A Rabbit Polyclonal Antibody

CAT#: TA339292

Rabbit Polyclonal Anti-MAT2A Antibody

Product Images

WB Suggested Anti-MAT2A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Hela cell lysate.MAT2A is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MAT2A antibody: synthetic peptide directed towards the middle region of human MAT2A. Synthetic peptide located within the following region: LLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: methionine adenosyltransferase 2A
• Database Link:
  NP_005902
  Entrez Gene 4144 Human
  UniProt ID P31153
• Background: The protein encoded by this gene catalyzes the production of S-adenosylmethionine (AdoMet) from methionine and ATP. AdoMet is the key methyl donor in cellular processes. [provided by RefSeq, Jun 2011]
• Synonyms: MATA2; MATII; SAMS2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Pathways: Cysteine and methionine metabolism, Metabolic pathways, Selenoamino acid metabolism