SERTAD2 Rabbit Polyclonal Antibody

SKU TA339233

Rabbit Polyclonal Anti-SERTAD2

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SERTAD2 antibody: synthetic peptide directed towards the N terminal of human SERTAD2. Synthetic peptide located within the following region: LQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLRRIQEELKQEGSLRP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 34 kDa
• Gene Name: SERTA domain containing 2
• Database Link:
  NP_055570
  Q14140
• Background: SERTAD2 acts at E2F-responsive promoters to integrate signals provided by PHD- and/or bromodomain-containing transcription factors.
• Synonyms: Sei-2; TRIP-Br2
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 77%

Reference Data

• Protein Families: Transcription Factors