OriGene Logo

GPSM2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339182
Rabbit Polyclonal Anti-GPSM2
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY415680 Transient overexpression lysate of G-protein signaling modulator 2 (AGS3-like, C. elegans) (GPSM2) 100 ug
$436.00
TP305650 Recombinant protein of human G-protein signaling modulator 2 (AGS3-like, C. elegans) (GPSM2), 20 µg
20 ug
$737.00

View other "GPSM2 or NM_013296" antibodies

Specifications
Specifications
Product Data
Application IF, IHC, WB
Recommended Dilution IHC, WB, IF
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GPSM2 antibody: synthetic peptide directed towards the N terminal of human GPSM2. Synthetic peptide located within the following region: YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 76 kDa
Gene Name G-protein signaling modulator 2
Database Link
Background Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins.Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins (Blumer et al., 2002 PubMed 11832491). supplied by OMIM
Synonyms CMCS; DFNB82; LGN; PINS
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Pig: 93%; Guinea pig: 86%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins, Nervous system Diseases
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.