Fank1 Rabbit Polyclonal Antibody

CAT#: TA339166

Rabbit Polyclonal Anti-Fank1

Product Images

Host: Rabbit; Target Name: Fank1; Sample Tissue: Rat pancreas lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Fank1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Fank1. Synthetic peptide located within the following region: RPHPPVVGKVTHHSIELYWDLEKREKRQGPQEQWLRFSIEEEDPKMHNYG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: fibronectin type 3 and ankyrin repeat domains 1
• Database Link:
  NP_001008348
  Entrez Gene 309071 Rat
  UniProt ID Q66H07
• Background: The function of this protein remains unknown.
• Synonyms: 1700007B22Rik; HSD13
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%